PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016447582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 167aa    MW: 18959 Da    PI: 7.3005
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016447582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-18115167254
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+
  XP_016447582.1 115 RKKLRLTKEQSAVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRAR 167
                     678899*********************************************98 PP

2HD-ZIP_I/II78.31.3e-25115167153
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRAR 53 
                     +kk+rl+keq+++LEe+F+e+++L+p++K +la++Lgl++rqv+vWFqnrRAR
  XP_016447582.1 115 RKKLRLTKEQSAVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRAR 167
                     69**************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.9E-23289IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.99E-17103167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-17106165IPR009057Homeodomain-like
PROSITE profilePS5007116.957111167IPR001356Homeobox domain
SMARTSM003892.5E-8113167IPR001356Homeobox domain
PfamPF000467.5E-16115167IPR001356Homeobox domain
CDDcd000861.16E-13115167No hitNo description
PRINTSPR000311.6E-5142151IPR000047Helix-turn-helix motif
PRINTSPR000311.6E-5151167IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MEDLGLSLSL SFPQNRTVTN LIRKTSWTDN SFPSSDRNSE TCRVETKTFL KGIDVNRLPE  60
TADAEEEAGV SSPNSTISSV SGNKRNDREA NCEEHDMERA CSRGISDEED GETCRKKLRL  120
TKEQSAVLEE NFKEHSTLNP KQKLALAKRL GLRARQVEVW FQNRRAR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590779.11e-118PREDICTED: homeobox-leucine zipper protein HAT4-like
RefseqXP_016447582.11e-120PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466001e-55HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLK4CNI92e-85K4CNI9_SOLLC; Uncharacterized protein
STRINGSolyc08g078300.2.15e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.16e-40homeobox protein 2